PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_04770.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 317aa    MW: 35872.9 Da    PI: 9.3555
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_04770.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.97.6e-1676121147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg W + Ed +l+++v+q+G+ +W+ I++++  gR++k+c++rw++ 
  Rsa1.0_04770.1_g00002.1  76 RGHWRPTEDAKLKELVAQFGPQNWNVISNHLL-GRSGKSCRLRWFNQ 121
                              899****************************9.***********996 PP

2Myb_DNA-binding52.31.3e-16128171146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              + ++T+eE+++l+ +++ +G++ W++I+r ++ gRt++ +k++w+ 
  Rsa1.0_04770.1_g00002.1 128 KSAFTEEEELRLLAVHRAYGNK-WALISRLFP-GRTDNAVKNHWHV 171
                              578*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.80371122IPR017930Myb domain
SMARTSM007172.5E-1375124IPR001005SANT/Myb domain
SuperFamilySSF466898.61E-2876169IPR009057Homeodomain-like
PfamPF002492.8E-1576121IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2477129IPR009057Homeodomain-like
CDDcd001674.50E-1279120No hitNo description
PROSITE profilePS5129424.747123177IPR017930Myb domain
SMARTSM007174.6E-14127175IPR001005SANT/Myb domain
PfamPF002493.8E-14128170IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-19130176IPR009057Homeodomain-like
CDDcd001671.36E-10130170No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051782Biological Processnegative regulation of cell division
GO:0071367Biological Processcellular response to brassinosteroid stimulus
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MNPNLLEKVQ TSNETIHGLR RFKETNNFGS APNSQTDFSL ARNHPLNKSS VSVLKLEDEH  60
DKGRGNSGIK AKVCSRGHWR PTEDAKLKEL VAQFGPQNWN VISNHLLGRS GKSCRLRWFN  120
QLDPRINKSA FTEEEELRLL AVHRAYGNKW ALISRLFPGR TDNAVKNHWH VIMARRTRES  180
QRQRHQPPEA PSGNTEMAVS SSYNHGDEFF GTVANGTFVN EEDDDDDGSA VSTCTTELSL  240
TPPSSTHQPR FFNYDYTLAS GKDGQCVQKA EVNGKYSKKM DHQNHHTITV SERKVEMKMK  300
SGHYFFDFLG VGASRLT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-32761777108B-MYB
1h88_C3e-317617758159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-317617758159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00516DAPTransfer from AT5G17800Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667390.0KC966739.1 Brassica napus MYB transcription factor 56 (MYB56.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001302949.10.0myb-related protein Myb4-like
TrEMBLA0A0A7BW850.0A0A0A7BW85_BRANA; MYB transcription factor 56
STRINGBra023637.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99771836
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17800.11e-158myb domain protein 56